PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462893456
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family B3
Protein Properties Length: 90aa    MW: 10343 Da    PI: 8.6164
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462893456genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B3543e-1714793198
               .--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
         B3 31 eesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98
               + + ++tl d++g+sWev + y+k+sg+ ++ +GW  Fv  n+++  D+++F++   ++++++v+vfr
  462893456 14 KANAKVTLWDPQGKSWEVCYMYSKSSGGAYFCRGWGAFVVGNNIEKDDICIFYFF--KKKNMKVGVFR 79
               34569************************************************75..577789**998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM010194.9E-4181IPR003340B3 DNA binding domain
PROSITE profilePS5086313.239181IPR003340B3 DNA binding domain
CDDcd100177.15E-18179No hitNo description
Gene3DG3DSA:2.40.330.104.1E-19279IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.49E-20279IPR015300DNA-binding pseudobarrel domain
PfamPF023624.9E-15479IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 90 aa     Download sequence    Send to blast
MEFPSDIVMK YLPKANAKVT LWDPQGKSWE VCYMYSKSSG GAYFCRGWGA FVVGNNIEKD  60
DICIFYFFKK KNMKVGVFRV LQETTPSSEC
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0A9NR789e-25A0A0A9NR78_ARUDO; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44613766
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.11e-07B3 family protein